DPCstruct | MC25529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.77 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6LZI4 | 1-85 | MNISLLSAHEFPEQLNVIITSFNKYGDEIYCRYFDKSMRELGQPFKSVVFPEYNVHCLRREGAKFVSLSDTPTGTPEYPVVITDR |
| A0A0K0D8Z7 | 20-105 | QGGPKMNISLLSAYEHPDRIYVLMTSLNKYGDTIYCRYFDHQRGEISPPIKTVVFPEFIALCPRRGGARYMSLTDEPTDAYEFPLC |
| A0A016WMU9 | 75-164 | None |
| A0A158R028 | 27-121 | None |
| A0A158QXH5 | 320-405 | None |
| Q18918 | 413-500 | None |
| A0A2A2KUQ8 | 112-201 | None |
| A0A0D8XL53 | 18-113 | None |
| G0P8H3 | 229-318 | None |
| A0A2Q4T1Z2 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.