DPCstruct | MC25527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EP37 | 1-77 | MLCTFRCTSLLAGEKYPDGCGGGSVCFVRRKNQVYLQDVEEREDGGTPAIVESIRAGLVMQLKQAVTSEVIFAREEE |
| A0A822FC55 | 17-92 | ILIAKKKLFTNRVPSECGGGTVNFVTRTNVEYVKDIETREEGGTPNILGAIRAGLAFHLKEAVGEKIIEKREEELF |
| A0A5K3EMP3 | 2-88 | None |
| A0A1I7XH01 | 61-149 | None |
| C3XWF9 | 193-266 | None |
| A0A7X9BVU6 | 7-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.