DPCstruct | MC2552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 355 ± 50 aa |
| Standard deviation of domain lengths | 49.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535K4G5 | 4-310 | AALVLLATGVIFLGGTILLFVFNDPSAESTRGQLAVFTAMTVVALPVWAVHFWFARRFALRDPFERASALRRLYLYWACLTTSVGAM… |
| A0A2H5YNU8 | 2-299 | ALGGAILWPWHWAHSGGRQRGQPLRHFYLYAFALLGGAAVAIAAAATALYGTLAWALGATAEAAGLHFRFLPGAVSALLVGVTLWAY… |
| A0A3L7YD09 | 2-329 | None |
| A0A3M1I1L0 | 57-475 | None |
| A0A3N5LGE1 | 41-467 | None |
| A0A535E105 | 1-271 | None |
| A0A3L6ZQ12 | 165-540 | None |
| A0A536DBN1 | 57-410 | None |
| A0A7Z9INE6 | 43-431 | None |
| A0A1M3JYN4 | 164-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.