DPCstruct | MC25519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 174 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0001- CL0741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0D1P4 | 452-683 | MFTTSKDEDKKFDVFPEANLRSGPIYKMAPMYDMPLVNLQPFQSAVNLQYGLQRCPDDASSIISDCGDSVPCLYNYALLQSKVLAFE… |
| A0A401NJ85 | 351-492 | PEDPLYAEMQALCQENKFCRFDTLVTKSLKVGNATKVSYESYVTLIESLEPVTSCGFLEEPKNGKKKGNFYLIGALVNFTCNQGHVL… |
| A0A016WP11 | 18-198 | None |
| A0A0K0DSX8 | 1616-1813 | None |
| A0A315VB21 | 15-136 | None |
| A0A2R7VU69 | 453-596 | None |
| K7HIH6 | 65-249 | None |
| A0A3P7ILR8 | 5-187 | None |
| A0A3P7IMY1 | 78-227 | None |
| A0A0B1SI08 | 106-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.