DPCstruct | MC25516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 290 ± 45 aa |
| Standard deviation of domain lengths | 45.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3WQG6 | 1-248 | MQILDEIRTEGDRIAFLKSAAEQLLVRARVKLNLKNLYQANGFAVKELLKVAALLHQAHRGATDDDEQNELSFDLGPGHAFADLKTT… |
| A0A0K0CVE8 | 1-243 | MTRAIGYPRILSLENFRTPNFKLVAELLEWIVRRFDPSAAISAEQTATEQERVLFIKQAVLLLLQNTRLKLNPRKLYQADGYAVQEL… |
| A0A1Y2HG48 | 13-349 | None |
| I0YMC7 | 3-266 | None |
| A0A6A4VVY8 | 1-292 | None |
| A0A0R3T1A5 | 13-291 | None |
| A0A391NXE7 | 2-238 | None |
| A0A2T7PZL0 | 13-311 | None |
| A0A671FJX8 | 300-588 | None |
| C5KSL6 | 13-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.