DPCstruct | MC25512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 8.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1L659 | 62-184 | QQEVLREQIKQSEQNLNAQHTVLLQQQQAQVENLVTKCEMAELQREAEASELPLDELYAILQPIIDSCTKDSISNGKSWILQHSSTK… |
| A0A0K0CTS8 | 1-129 | MNIQKEQLKQQITDSERNLKAHLDSIPAMKEAQVAQAVVLSESQKMSQILANVNFNVAPLGTILDQLNSGKCSKDLVSASRKWIFEN… |
| A0A7R9E6W8 | 244-364 | None |
| A0A0R3RBP0 | 104-226 | None |
| A0A7J7AYB3 | 299-422 | None |
| A0A6A4RQ72 | 191-339 | None |
| A0A0R3PD85 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.