DPCstruct | MC2551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1XBQ3 | 41-119 | DNVSQKQTPELEQLIPEGCVCKREAKTFVCIMCKMFSYGRIAELCSIHPNVSYLMDFTCCPYCSGPSEHLHIVNMEYDR |
| A0A183D9R4 | 2-61 | QNCICDRPASHIVCTRCGFELVGRLQKVCPEHPKKLALMDHRECPNRLCKSIHLIEVSLQ |
| A0A0N5AID5 | 109-180 | None |
| A0A0R3RHJ3 | 66-144 | None |
| A0A0B2UU47 | 135-226 | None |
| T1GBG0 | 4-71 | None |
| A0A7M7LSX0 | 66-148 | None |
| A0A1D2N7W7 | 24-116 | None |
| T1F3N6 | 32-105 | None |
| A0A2A6CD35 | 168-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.