DPCstruct | MC25505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9QTB2 | 579-652 | LRPHYSRGEDEARALLREAFTLPGDLEIIDGTLHVRLDPASAPRRSKALAGLCAELTDTQTTYPDTDLVLAYSV |
| A0A2M8BE01 | 10-77 | DEARALVRALFVSSGDIEPDERSNTLTINIHRMATPAHDKALGLLLADLTDQAFCHPQTGAKMIFCLV |
| A0A6I7WSK0 | 164-236 | None |
| A0A7V3T697 | 28-108 | None |
| A0A846NBX0 | 54-143 | None |
| A0A7V8DCH6 | 5-71 | None |
| T1AJT0 | 237-325 | None |
| Q1Q0V5 | 2-58 | None |
| A0A7X9AUK3 | 1-57 | None |
| A0A358SKW7 | 10-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.