DPCstruct | MC25501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2VQU8 | 16-116 | SPPMSDSGIMYPVQAPPVLSSGVGAAQEAGHVRVVQSRPKPQCWEHGCNGRQFSTFSNLLRHQREKSGQAAKATCPNCGAEFTRTTA… |
| A0A1Y2V156 | 1-111 | MASIQHISGNLASADPYPNALDKLSTGVPDFLGNPSSEDRSMDRNGKHRCWDHGCNGREFSSKSNFVRHVKERSGASTKGVCPLCGA… |
| A0A4V4IM68 | 54-150 | None |
| A0A5N7DL33 | 3-90 | None |
| N1JGB1 | 188-275 | None |
| A0A254UF79 | 133-235 | None |
| U7PM87 | 244-343 | None |
| A0A5N5X5E7 | 114-189 | None |
| A0A3D8Q8V8 | 142-237 | None |
| S3CJ79 | 307-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.