DPCstruct | MC2550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 570 ± 44 aa |
| Standard deviation of domain lengths | 43.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.20 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3KS56 | 2-580 | EASYLADKKKMKQDLEDASNKAEEERARLEGELKGLQEQIAETKARLITQQHDRAQEQSDHASMLRELQKLLQEERTQRQDLELRLE… |
| A0A0A1WE29 | 2-606 | TLMNSLATLSAEKSRMEASFQADKKQLRGQLTQKDDYIAELKKTIKENDVKAKAHLDEIKAKWIIECQEREKETNNQMVMIRELQKL… |
| A0A4U5NED5 | 15-542 | None |
| A0A482XMK4 | 103-684 | None |
| E4XNB5 | 6-618 | None |
| T1F2R0 | 120-769 | None |
| A0A0K8T8F2 | 2-546 | None |
| A0A0V1HCE4 | 3-483 | None |
| A0A7S2AIC9 | 6-549 | None |
| A0A5E4R5K2 | 69-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.