DPCstruct | MC255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396GHB8 | 1-68 | MKLEFHTNKNEIKGISHPRNKKELWRDIHKVLEDRGFKAYYQRLYLENDKLKIDFGSHTEFFYVTDLT |
| A0A125W4Y0 | 1-73 | MKYQVSWENKLTNEINIHGTFETLQDALQSIYDWWDKNEFTPRYIRHWNTGNRATIDYGSHHMFYYISEVEDE |
| Q8DXI2 | 1-75 | None |
| A0A1G9V9H9 | 2-68 | None |
| A0A1H3YWA8 | 323-401 | None |
| A0A372DXI6 | 42-117 | None |
| A0A1Y3SLE6 | 95-179 | None |
| A0A7X8VCV0 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.