DPCstruct | MC25497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 243 ± 48 aa |
| Standard deviation of domain lengths | 48.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4JZI4 | 179-385 | KLDITLVKGPEGGSHKRIKKCIVNPGNHKCYIRPDNPHENEAYTTLTNTALVDFIPKFYGVENKAAVVEDVAADFKSPCIADFKIGA… |
| A0A0L8FVG7 | 1-197 | MDVKMGIRTYLEDELKKARENPKLRSDMYEKMVDIDPSAPTPEERELGAISKPRYMQWRENISSSSSLGFRIEGVKNSNGVSSKDFK… |
| A0A1I8HYE2 | 102-358 | None |
| F8LB23 | 58-305 | None |
| A0A6A5DAS4 | 1-135 | None |
| A0A7S1FFC6 | 27-326 | None |
| A0A4T0JIR8 | 797-1097 | None |
| A0A0C9M9Y8 | 649-925 | None |
| A0A0V0QAG9 | 58-322 | None |
| E9G3K0 | 21-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.