DPCstruct | MC25496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 441 ± 126 aa |
| Standard deviation of domain lengths | 125.81 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 75.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.77 |
| Pfam Score | 91.40 |
| Assigned Pfam label(s) | PF14648- PF14647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4JX65 | 3-448 | QEEDTSTFLENAIPWEQLNASAQAYFGTPAQFQQRILSYFFDHQKPYNQALTFTNPAQYYQKLIEFGITNFLVFPYHLISELQQYNP… |
| A0A016RWZ1 | 16-322 | LPEDIRVLLGNSQREYDKLVLDYSIKNQLRYKGNLVRHVKKSEETYYDMIIKYSESHLMLYPYHLSDIIVRELRVTPFNYYINIITD… |
| G5BAU0 | 1-430 | None |
| A0A218X7N7 | 21-348 | None |
| A0A5J4W7B8 | 41-362 | None |
| A0A7J0EHB6 | 55-331 | None |
| A0A3Q0IMV8 | 1-499 | None |
| A0A5A9NQJ8 | 1-541 | None |
| A0A0R3S6N3 | 508-968 | None |
| D8QZ25 | 10-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.