DPCstruct | MC25494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 295 ± 58 aa |
| Standard deviation of domain lengths | 57.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4JSN7 | 1-309 | MKTNIQCIKGYLEQSELVGNQLMTIISSFVNSHASLIVEGVHLSVDVMLKIVKNFPNVVPFLVYIKKENFHRQRFAVRAKYMTTDPS… |
| A0A059LNI8 | 288-468 | VLQGYQEASDAVMAHVEALVVSHAQRRASLVVEGVHLEPGRVAALACRVPSCVPFVVHISNAAKHAERFAVRAKAMSLRPASNRYVR… |
| A0A058Z024 | 238-576 | None |
| A0A453MSF4 | 1-241 | None |
| A0A6J1KHZ8 | 4-456 | None |
| A0A077WB84 | 124-348 | None |
| A0A5J4VW01 | 1-283 | None |
| A0A453FVZ5 | 1-349 | None |
| A9RGG0 | 279-560 | None |
| A0A0Q3VLH2 | 109-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.