DPCstruct | MC25492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 22 aa |
| Standard deviation of domain lengths | 22.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0RZ31 | 21-143 | LKPQGIYRHNDSDMKIVKQLIRKGSLAPFYRGTTDIYSTKKISFETECPICFLFYPSNINKTRCCHKSICTECFLQFKRSSSSPLIP… |
| A0A0D2K2G8 | 35-170 | CRPRRPMPKAVDYRKLRKLIKCHKLAPCHNGLDMDCGSRDLEVDECPICFLAYPSLNQTVCCNKLVCTECFVRVQCSSKPPGKACCP… |
| A0A6U4KNC3 | 1-144 | None |
| W7TW00 | 18-129 | None |
| A0A7J7QDG6 | 1-144 | None |
| K8F2H7 | 1-190 | None |
| A0A287XU73 | 44-174 | None |
| A0A804HNW4 | 1-153 | None |
| J3MGE0 | 1-150 | None |
| A0A1Y1IIP8 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.