DPCstruct | MC25491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0G016 | 315-392 | IIGYTWKRGDKVLTADANAEPMWSRFVDLESNRPVFGDRDGSVYYDIGQVSQERLDGYAWFTTAPNKVLKKYAKWAKK |
| A0A069D0K3 | 13-86 | NHEYPYDLVVVKDLKAEPIWARFYEVTNNKPFMCTRAGEKVWRLADVDPERRTGYDWYGYWPKKVFEAYAKFIS |
| W4QBT2 | 689-757 | None |
| F8FI98 | 375-448 | None |
| A0A1V5MS35 | 151-225 | None |
| A0A7Y4UGY3 | 554-640 | None |
| A0A517TYR2 | 874-959 | None |
| A0A2D5VIF9 | 30-109 | None |
| A0A382LM16 | 1-101 | None |
| A0A5C4T1R1 | 419-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.