DPCstruct | MC25490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 161 ± 60 aa |
| Standard deviation of domain lengths | 60.32 |
| Length coefficient of variation | 0.37 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8XSA8 | 51-249 | LDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRAAISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTI… |
| A0A1B0VLA7 | 28-148 | ITISADGALKQMVLPAMIAIVTPLISGFTFGVDFVGGLLVGTTLSGIMLAIFTANAGGAWDNAKKHLEQGKIPGLAKGSAEHAALVV… |
| R7QL36 | 638-955 | None |
| A0A645JMS4 | 2-67 | None |
| A0A090MK05 | 145-321 | None |
| A0A7C2CT53 | 220-406 | None |
| A0A446K145 | 386-609 | None |
| A0A7W1C547 | 19-138 | None |
| A0A7Y2DHY6 | 108-333 | None |
| A0A1M5LAM3 | 87-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.