DPCstruct | MC2549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 252 ± 44 aa |
| Standard deviation of domain lengths | 43.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2N0I5 | 141-301 | QVPDEALSLVMSMGFGEGDAKRALRMSNQDIQSAVNFLVVEREKREQKREDDIRRRNEIMQQKRYGVTPLKKAVDLQRLTEVVSIGF… |
| A0A6E8W9A9 | 30-297 | KECRIALRACSNDVEAAIEFIHSQRETRRANERRSERERQLYRTIGHDASEGGDTLRLKLELVDQLMEMGYPEELAALALKRSANDI… |
| A0A8B6DG10 | 59-312 | None |
| D2W0Q1 | 321-644 | None |
| A0A2J8A8B9 | 274-583 | None |
| A0A484MHK0 | 1-263 | None |
| D8LR71 | 545-822 | None |
| A0A6F9CMU1 | 787-1004 | None |
| A0A2K6ST87 | 295-572 | None |
| F7AZ69 | 351-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.