DPCstruct | MC25478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 133 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8XWC5 | 49-188 | DEGIMNGVNVQLTTPDSLAIDSYISLIRNQPCPVCSSTAQPLNAIVIGSVKSFIILTHYKKKLMIACPSCLQQANQRATASTALMGW… |
| A0A445N8G5 | 7-137 | QPQSGQVHCRLCGGFPAVEATVRGHQGILIMMRSLSLKGPFCRNCGTAVWRDMTGKTLLQGWWSPLSLVLLTPFTLLWNLFVRVKIN… |
| A0A536DZP0 | 11-146 | None |
| A0A1A3JBG0 | 1-130 | None |
| A0A2T2UVM8 | 35-152 | None |
| A0A7H8LRN9 | 1-105 | None |
| A0A3M0ELR4 | 1-149 | None |
| A0A426U097 | 1-147 | None |
| A0A7K0W790 | 74-218 | None |
| A0A1S1RAL8 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.