DPCstruct | MC25475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 93 ± 21 aa |
| Standard deviation of domain lengths | 21.45 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A160JFY9 | 7-69 | VSYEVQSRREGRWLIEGAYTDQESALSAARSQLAASGVEEAKVVKFRTIAGLSLETVILHKTA |
| A0A2S6R8G8 | 2-102 | ENPNVFEVQTLKDGRWMIEQRCRNEEEAVAEAWDLFDSRHFQSVKVVREAFDQAAKLYRETTVFSLPNGNGDAAGPMVNEPIKSASA… |
| A0A1Y5EFU2 | 6-69 | None |
| A0A2E4A2T0 | 1-110 | None |
| A0A2H6B1S0 | 4-113 | None |
| W6K960 | 3-88 | None |
| A0A564WEN3 | 9-116 | None |
| A0A7V8DW32 | 1-111 | None |
| A0A1Z8SMN0 | 2-120 | None |
| A0A1N7IXZ7 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.