DPCstruct | MC25474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1UKM3 | 248-346 | GLCFAGPYAFVGLSKPRGSRTFGGLELEANLAARGAEPRCGLLVVDTRTGEVAHWLRLDGVVEELYDVAVLPGVRRPMALGLLSEEI… |
| A0A2S6R4Z0 | 1-101 | MCGLAFINGFAIIGMSKCRENRTFSGLDLDDNLTKRKVEARCGVFVVDLSTGDLVQWVRLEGAVFEMYDVAVIPGVVRPMALGLRQE… |
| A0A068MVK2 | 246-339 | None |
| A0A6M8VWB5 | 129-222 | None |
| A0A1Z8RNP8 | 1-108 | None |
| B5IQK8 | 510-606 | None |
| A0A1T2L238 | 87-180 | None |
| A0A5A5RCN9 | 260-359 | None |
| A0A7Y5SLG2 | 142-230 | None |
| A0A1H6Y7K0 | 194-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.