DPCstruct | MC25470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0REN9 | 9-134 | LLFWATAILGAVWLLLVALNVYVRSTKDANRARLIRDLGEPTVRLEEPLFLGLFHPYCNAGGGGERVLWTCVRDIQKEFRNVICVVY… |
| A0A1S4CPE0 | 5-113 | VIAVTVVIAQAVRLLLMVINGWRNRKKAVVVFHPYANDGGGGERVLWCAVKAIQDENPNLDCVIYTGDHDASPDSLTGRALDRFGVK… |
| A0A4W5KEZ6 | 18-114 | None |
| A0A2R7WCK9 | 5-138 | None |
| A0A2U3DYK9 | 579-720 | None |
| A0A498L602 | 22-153 | None |
| A0A0F7SRV8 | 1-171 | None |
| A0A183TRR7 | 3-137 | None |
| G4TUZ4 | 3-140 | None |
| A0A287QIZ0 | 21-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.