DPCstruct | MC2547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M4GRU8 | 2-87 | LRSTPYCNLIAQGRSQEGNDIAAVERIFIKGMKRDEIRFAWYKQVNGSERFQPRPLDLTEEELLKVLEDGVANGVFSTSFRENLKK |
| A0A1G8TH90 | 7-99 | IKSTIKETKYCSILAQGKVFDGEYTYCIEKVFVKELRQEEIRFSLYKDTLNQVERYIPRSLDVTEKEFLELFKEAVKHDVFSRELLA… |
| T0NFG3 | 103-182 | None |
| A0A679KJH4 | 1-79 | None |
| A0A1F2TJN7 | 2-73 | None |
| A0A511WYT8 | 10-92 | None |
| A0A1Q9PW76 | 3-91 | None |
| A0A2K8N2T7 | 57-148 | None |
| A0A7Y3VN63 | 10-92 | None |
| A0A6L9ERV7 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.