DPCstruct | MC25468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Standard deviation of domain lengths | 11.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 70.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4CLG4 | 1-133 | MLADKNAPNEKAWRQIEKMCLSTNASAIPVVPDSEGTEINPFSVDALAIFIFRVLHRANHPGNLDKSSPNAGCVLLMFYHLYEGKNR… |
| A0A453AW62 | 543-673 | ADKNAPNEEVWRQIEDMCGMTKAAAVPVIPDSEGTDSNPFSLEALAVFMFRVLQRVNHPGNLDKASPNAGYILLMFYNLYDGKSRRE… |
| A0A446KF31 | 107-239 | None |
| A0A2G3BAC0 | 437-572 | None |
| A0A1U8FYA9 | 819-961 | None |
| A0A287HEC1 | 672-805 | None |
| A0A453HB59 | 42-167 | None |
| A0A2P2M277 | 382-515 | None |
| A0A438KNR4 | 1-150 | None |
| M8ASH2 | 440-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.