DPCstruct | MC25465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 364 ± 54 aa |
| Standard deviation of domain lengths | 53.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 63.72 |
| Pfam Score | 68.18 |
| Assigned Pfam label(s) | CL0363- PF10597- PF12134- PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7I7W2 | 1-296 | MSHDEDQLIPNLYRYIQPWEAEFVDSVRVWAEYALKRQEANAQNRRLTLEDLDDSWDRGIPRINTLFQKGRHTLAYDKGWRVRTEFK… |
| A0A444G8G7 | 538-904 | LTLEDLEVFDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDVIQALGGVEGILEH… |
| A0A7S4PR46 | 288-636 | None |
| A0A1D6FVM4 | 586-924 | None |
| A0A0R3TIL3 | 1-360 | None |
| C9SPU0 | 1-428 | None |
| A0A0S7F200 | 11-356 | None |
| A0A482S0J1 | 64-454 | None |
| A0A0S7F0G9 | 47-437 | None |
| V6TU29 | 62-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.