DPCstruct | MC25463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 446 ± 53 aa |
| Standard deviation of domain lengths | 52.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4QUB1 | 143-580 | RPDDLLATKGIATAALALPNRDGNLLARVAAKRDRLLQHLRGQSTPDNPASSRPFVREGQRIERAILEEEYAFRMEQVLSVQVSRLT… |
| A0A0C3ECQ6 | 60-581 | MSNFHLRLNQIDLDIRPPVDEDAVYTDDEDDDMQIIRGAPVLRPLGSQIYNSLSHCVHNEAKFHAVQLGLVMSAFAGSSAATASGRH… |
| X0HT56 | 181-658 | None |
| A0A0B4GP90 | 257-628 | None |
| A0A4Y9ZZK4 | 245-658 | None |
| A0A2P4Z6Y6 | 8-409 | None |
| A0A3N4J6Y0 | 252-796 | None |
| A0A4R0R8K0 | 103-595 | None |
| A0A4V1RXQ9 | 1-479 | None |
| A0A0C3MZK6 | 90-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.