DPCstruct | MC25461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9GJD4 | 551-667 | VVCDPGCHGVNFGAKKGGGYYAYVTSKFSNRLIVLDYDADNDGIVTQTGADAPVIAGWVVLADDAAPTDDPISGNKGMGGQGLLPVP… |
| A0A7S6LXC7 | 1-111 | MPLKISGCHGANFGAKEGGGYYAYITNKFSNRLIVVDPDPNGDGDLSDAEIAGAVTLVADHRVPKDDKISSLAGFGGQGIVALPNVY… |
| A0A2P7NTU7 | 790-896 | None |
| A0A2V6Z9S7 | 679-790 | None |
| A0A6B1FDN8 | 982-1110 | None |
| A0A7K4F3H1 | 486-621 | None |
| A0A7K4DS83 | 288-423 | None |
| A0A523PAH3 | 148-258 | None |
| A0A532EYW7 | 431-534 | None |
| A0A532ESQ6 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.