DPCstruct | MC2546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376W1P5 | 148-277 | IQAGYSVEQQREVFEFVASSDYFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGPMFAGYKP… |
| A0A1G8QR31 | 52-166 | LVQTSFSTKDKVDVFNFVASSGYFSGPTWMALAKNAMDAAHNVEYRSILTTMARNGYEFGIRVSGLEGNQWFTGPAQVVVGPLFAGF… |
| A0A7X7IWT6 | 263-395 | None |
| A0A6L8W9M2 | 378-487 | None |
| A0A354U761 | 202-332 | None |
| A0A0M0K0G8 | 853-979 | None |
| A0A1G9AAJ4 | 289-413 | None |
| A0A379WDI4 | 30-162 | None |
| A0A2V6TAC4 | 774-910 | None |
| A0A8B5W7B0 | 514-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.