DPCstruct | MC25456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 138 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 14.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7R3B2 | 57-212 | EADIEDLNEDNIETDNDTASFDLDIDPDGENNVTLQLEQEGMVSKIAYKAEGDRVIEQTADSIIPYDLLEIADKEEAEAMFEEGVAQ… |
| I0S7L8 | 5-143 | KKETVVTKTLSFPKTAEGIQQTQTITYKGDQFLSLTIEQIMPMKEEMKKVVAEVGVAEAQKLLEKSLAEDEKFTQAKSLEGFSTSLE… |
| A0A447U032 | 1-93 | None |
| A0A356K2T8 | 332-446 | None |
| A0A396QJP5 | 273-402 | None |
| R5LI01 | 73-229 | None |
| A0A0F3H696 | 25-185 | None |
| A0A6G7ZC09 | 29-151 | None |
| A0A4Y9J3Y5 | 10-156 | None |
| A0A662Z7P0 | 23-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.