DPCstruct | MC25454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 191 ± 35 aa |
| Standard deviation of domain lengths | 34.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 84.07 |
| Assigned Pfam label(s) | CL0021- CL0198- CL0214- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6TUM6 | 1-138 | MISSLRGVVLHSDADSVIVEVGGVGFSVAVPTDVARGLRAGDETLLHTNLVVREDALSLFGFAGRDELDTFTLLLSVSGVGPKSALG… |
| A0A6N7QVI6 | 22-228 | REQGIIKVIKYKKDNFMIGILQKQNGEDITFKGNIFGIEKNEEIIFKGKWTEHIKYGKQFEVTKWERPIPKTKEKIISYLSSPFIKG… |
| B5Y8Y7 | 4-177 | None |
| A0A1D2P7P5 | 16-180 | None |
| A0A1V5RDL8 | 2-225 | None |
| A0A5C9EI62 | 5-174 | None |
| A0A6M3K1Q0 | 2-187 | None |
| A0A3S6Z139 | 8-225 | None |
| A0A1Y5EEG9 | 672-813 | None |
| G9PKX7 | 1-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.