DPCstruct | MC25453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6K8W4 | 14-136 | QRPDRRLIYFADFGLALSSRFELTPSETDFLTDHLSYDRGYVTAHRIRHHLLDDDHDNAEHARFLHDWTAGRRPDGVRADAAALLDR… |
| A0A1I0L5C4 | 28-164 | MNAGGLLHFDAHFENVLTDGRRFYLTDFGQAVSSRFDLSEEERAFYRRHLTFDRTYTLTYMLNWLAGAFHGADWQGRRALVRGWAAG… |
| A0A7W8BTQ7 | 15-115 | None |
| A0A561TRW7 | 26-131 | None |
| A0A1B2HMD6 | 108-236 | None |
| A0A7W9LX66 | 159-305 | None |
| A0A559V1C7 | 12-148 | None |
| A0A5R8PD99 | 87-226 | None |
| A0A8A9APJ9 | 2-136 | None |
| A0A7Y6IPH9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.