DPCstruct | MC2545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 83 ± 3 aa |
| Standard deviation of domain lengths | 3.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8HZM5 | 56-139 | EKVLYACDELAGFLTAVSYVKPSRSIHEVDAKSVRKKMKDKAFARAINREEIVSGAAELGVDLDEHISFCIQAMRTRAPELGLQ |
| A0A1G8NU98 | 20-104 | QESHCFSCGSVKGLIYATVLMRPDRSISVLELKSVKKKFKAASFAQGVNRDVIKSGAKMLGMDLDHVITETIEGMKKAKDLLDLN |
| A0A534PWJ7 | 477-563 | None |
| A0A7W0UD44 | 1-86 | None |
| A0A847M837 | 39-119 | None |
| A0A0G1HTL1 | 154-235 | None |
| A0A7V9QET2 | 2-86 | None |
| A0A7U9SF69 | 513-595 | None |
| A0A7X4E0V2 | 151-238 | None |
| A0A0G0AQ71 | 33-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.