DPCstruct | MC25446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1Z8X5 | 2-160 | MRKLIKNFLTKRALRQWALAPIVIVTIGLGWKYYWLAFSVPMVILINMLSPLLSRGRFVCGNTCPRGAFFDRILRHFSQGKKIPGFL… |
| F5YGR7 | 37-186 | WSWIITIVWITIANIWKPFGLYGFVCMFTPIGIALSGRGKMHCARICPRGSFIKVFTRRISLHLPKPAFMKKTAFRWALWGLMMGSF… |
| H0UNH5 | 4-149 | None |
| A0A8B2XGD9 | 9-197 | None |
| A0A3C1ILB0 | 9-188 | None |
| A0A1I0EHG9 | 4-163 | None |
| A0A4R7LCG9 | 2-161 | None |
| A0A812U752 | 67-241 | None |
| A0A2V3JJY0 | 57-182 | None |
| U2DSC7 | 4-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.