DPCstruct | MC25444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 70.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369A8L5 | 201-271 | EERRAVLKAELDALYARLYGLTTEELRYILDPQDVYGPDFPGETFRVLKEKEIRQFGEYRTKRLVLEAWDK |
| A0A085L5N4 | 1-73 | MLKAELDALYARLYGLTTEELRYILDPQDVYGPDFPGETFRVLKEKEIRQFGEYRTKRLVLEAWDKLQEQSAQ |
| A0A259JX27 | 94-164 | None |
| A0A0K6HK76 | 377-451 | None |
| T1APC9 | 298-366 | None |
| A0A7C0U3G8 | 28-93 | None |
| A0A414BJU5 | 52-121 | None |
| A0A2W5HBH0 | 17-95 | None |
| A0A1Z4SJX7 | 469-531 | None |
| A0A060USX1 | 834-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.