DPCstruct | MC25442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A552Q942 | 4-105 | EPFTQAAQQWDLQTLYADLTFAKGKPLTPVEKTHLRGLLCGCSPSEIAEKLHKNSNGVETDLCATVYRYVKNLLDKNNGRIDNWRNI… |
| A0A6P0XM57 | 2-107 | AQIDKIFSQAGQEWDLESLYADLASAKGKHLTPIEKAHLRGLLCGFSPSEIAEHLGKIPRGVESDLCATIYRYVKCLLDKVEKVENW… |
| A0A1Y1Q4A2 | 4-114 | None |
| A0A845Y126 | 8-116 | None |
| A0A090AJ36 | 19-134 | None |
| A0A1J5GVC5 | 3-120 | None |
| A0A1D2PCC9 | 18-147 | None |
| A7BXZ2 | 1-95 | None |
| A0A7C9PWJ4 | 5-120 | None |
| A0A6P0QSJ9 | 4-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.