DPCstruct | MC25440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 16.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0XJ84 | 1-150 | MNKSDITTTSESTSHLEIAIGQYATKLDRLDSSETEVTETRVYEVLLARDAVENLLRKRVEGTESPLAELVELDQRLKVHNDLIGTT… |
| A0A6I5PP93 | 6-154 | PLQHAYNKYHQLVANLGQLSQWSHADVLGLLQQRDRIQQLIDHLAQQPDSPYISPQFWLRLAEDDKTLGQQQAQLLDKGHFNDWRKS… |
| A0A2Z5X1B6 | 7-164 | None |
| A0A6G3Z2Y1 | 5-162 | None |
| A0A6M8BB15 | 16-177 | None |
| A0A3M2GWR9 | 25-188 | None |
| A0A1Z4JB62 | 2-142 | None |
| A0A6I5Q1X8 | 1-209 | None |
| A0A1D8TM26 | 1-172 | None |
| A0A3G9JJV1 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.