DPCstruct | MC2544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 50 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8EDE2 | 1-48 | MAKTAAFHSVKQTVYHNNTSCTEGNNIEKVNLRPGTGGKPLCSHCSRL |
| X1ERC0 | 6-50 | KVESWHSVKGDVYHNHTKCDTGNNIEFENRKIGTGNKKLCLKCAE |
| K1YLK8 | 36-85 | None |
| A0A6C7DYE1 | 18-63 | None |
| A0A1M3F795 | 1-59 | None |
| A0A7Y5CZC0 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.