DPCstruct | MC25437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 220 ± 15 aa |
| Standard deviation of domain lengths | 15.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 67.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1FX40 | 578-797 | HESLTRSFQLAFSLRSISLGGESSLAPSRRRSLFMLSTSMMVFSSKAFNIAPLIPIVKSSLNEKTMDPFLCLVEDSKLNVASTAYDH… |
| A0A5B7ANK2 | 3-232 | LIRCFQLAFSLRSSSLDQEGGLQPSHRRSLFTLASYMLIFSAVAGNLPDLIPIVKSSLTDETLDPYLELVEDIRLQAVCIRPGSKDK… |
| A0A7J0F332 | 500-735 | None |
| A0A7J9J9H1 | 1-193 | None |
| A0A6A5N6E5 | 1-202 | None |
| A0A438CZG1 | 464-699 | None |
| A0A811SA29 | 658-878 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.