DPCstruct | MC25434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 262 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078IG48 | 1-276 | MSQWEPSPFIRSSAQEAGNIVLEKTPNVFESIISETEQEEQTTNSHQVQVFKWPIWLLGPSVLLTSGMAPTLWLPLSSVFVGSNVVS… |
| M1BES3 | 3-238 | EESKLVSSPFEEKRGSFLWVLAPIALISSLVLPRFFIVVAVDDLIKNATLAEIVSSLFSEVMFYIGLATYLRVTDSVQKPYLQFSAK… |
| A0A7J8SHJ9 | 80-359 | None |
| A0A218WQJ7 | 1-278 | None |
| A9RTA1 | 1-239 | None |
| A9SFM2 | 267-525 | None |
| A0A4D9B5Q8 | 964-1233 | None |
| A0A176WIM0 | 219-486 | None |
| A0A0K9P510 | 67-324 | None |
| A0A498JQT0 | 391-649 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.