DPCstruct | MC25430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 403 ± 82 aa |
| Standard deviation of domain lengths | 82.33 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 65.91 |
| Assigned Pfam label(s) | PF13297- CL0016- PF12108- PF16837- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5DAY5 | 4-399 | VLEVQRRLHEERDRLIDTMTKEFLHERKSHKEKINGDHRLRRLVDRYHEVTKKLRLLYEDEDKSRKLELRAIASPNEFAEFYSRLKS… |
| A0A0L0NIE9 | 5-404 | EEERYIHEDVERIESSIADRVRDDPKHIRNLLNRDHEIAQLLDQIQEQAKHLQGIFNDDVGSTARDLEHLGAVDSFGEFYNQLNELR… |
| A0A803QBT6 | 5-470 | None |
| L1LE89 | 647-1098 | None |
| K0TRI9 | 20-558 | None |
| M7Z113 | 7-279 | None |
| A2DYJ8 | 3-471 | None |
| A0A1X1BK82 | 608-1096 | None |
| A0A803LVD0 | 6-321 | None |
| A0A6M7YZE4 | 4-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.