DPCstruct | MC2543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L4IZV5 | 1-72 | MSEDEFWCIIELSSIRSNKIIKALYEYMVLKHSRAVSCNNNGVSNGYFGSCLARIEYVIQVVSELFSHYKNT |
| A0A2S4Q739 | 36-125 | KEKPTHSYMGTPGYLHPGSVHPEHFRLLVGISNIYSERIRIALELFLVRGLTRQESCDEAGISQSCLSIKLRQIQSISRAVTEMHPW… |
| A0A0D6H2Y0 | 7-82 | None |
| A0A336QWJ0 | 1-76 | None |
| A0A336QWV6 | 1-93 | None |
| A0A6M3JBK7 | 1-80 | None |
| A0A0H2YFS5 | 137-226 | None |
| A0A2X7KE35 | 11-103 | None |
| A0A7I6WR52 | 5-86 | None |
| A0A3D9VY03 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.