DPCstruct | MC25429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7YB48 | 134-215 | GVRSARDPAWRLVVPLVEDMEWRFTNLEDSPNETEEIVDFGYTSFLGTIEEIHGKGAAVWAEEAAFLARWWVDENRRRYRYT |
| A0A0L0ND97 | 3-88 | AVRDGRQPNWRLIVPVVDNIEWRFTDLGSDPHEQEPVVSFGFWSLLHSVERRHGREAAEWVEEAAFMARWWVEENSKRWRYGPYAE |
| A0A2N1L4E6 | 26-107 | None |
| A0A1V6YFU7 | 256-337 | None |
| A0A151GJY5 | 974-1047 | None |
| A0A3D8RZS8 | 553-626 | None |
| A0A0A1T677 | 15-100 | None |
| A0A1B8A8G9 | 1155-1232 | None |
| A0A2B7WS40 | 64-144 | None |
| A0A1B7NS15 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.