DPCstruct | MC25426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 237 ± 41 aa |
| Standard deviation of domain lengths | 40.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0N0Q5 | 1-249 | MSVPAVEYAIQTLLRMSMDKFLLCNIDVLMEYEGAIQRLADAIPTTSWNPFCLKTCLSLYTGIKAQTIRANALLCLPTSNRRIHDLR… |
| A0A067T0H8 | 678-945 | VRRLIVLVNACASSARLKLDELPDILIAMLLLGMDSGASPDILRDVSQAVEKICHCIPPDLRLEIPLSSKLLACVASYEPINKDRFL… |
| L0PB57 | 4-191 | None |
| A0A445EG46 | 123-311 | None |
| A0A7F8QTV6 | 370-650 | None |
| A0A1C7NPH6 | 305-509 | None |
| R7TZ25 | 169-403 | None |
| A0A6S7IIF4 | 4-228 | None |
| M5G2N2 | 906-1145 | None |
| A0A166L1A6 | 2-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.