DPCstruct | MC25422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 188 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2WG24 | 7-194 | WAKETFGEVAGALADAIPACLTRAHERARNGHQGVHTQTLEAYGHGLHAVQYEELAAGLEQIPGATAVRLQARTVMIVADNVIYPIR… |
| A0A5E7AMG0 | 12-186 | LSFDKMAAISKAIALGYRASSEIIRGNAVLGTNAMAASGHIKRACVDHFLSAVPGSAPESGISARMESNRNGSSKHIVLRSGRLVLT… |
| A0A1F0CPB2 | 2-183 | None |
| A0A829EPV6 | 1-165 | None |
| A0A0M8W2J2 | 1-176 | None |
| A0A838KSK1 | 1-135 | None |
| A0A7W1E4S7 | 5-195 | None |
| A0A5B2U9M8 | 24-207 | None |
| A0A098Y873 | 4-188 | None |
| A0A248TIX8 | 7-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.