DPCstruct | MC25421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7D3T4 | 13-89 | VYSEIGELESVLVHEPGREIDYITPARLDELLFSAILESHDARKEHKQFVAELKANDINVVELTDLVAETYDLASQE |
| A0A5E6ZZF3 | 3-77 | KLKLGVHSEAGKLHKVMVCSPGLAHQRLTPDNCNDLLFDDVLWVAQGRRDHFDFVARMRERSIDVLEVHNLLTDF |
| A0A7K1HY43 | 1-73 | None |
| A0A7I8CUW8 | 5-82 | None |
| A0A2V7J7W0 | 1-87 | None |
| X8DNB1 | 7-74 | None |
| R5N9K3 | 8-89 | None |
| A0A4U9WNU7 | 8-74 | None |
| A0A090P4Q5 | 1-91 | None |
| A0A378SRN2 | 2-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.