DPCstruct | MC2542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 14.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S5C0E1 | 6-139 | FERKIWGFRYHELVRGECCRKVFGRKVCVPCPVSRYVDYSIYLGFNHPSVTPSWQASIYSCASAAVAAAYSILAPAIASCSAGPGCI… |
| A0A243TCN1 | 48-200 | LSSGGQYGRKKIAQWGDPLTPPQTRTRCIGEAWGNWPWGGEWRTCNQWATDYRTMQVEVYMNGIGPTDLSEAARSVVENIVATCVGL… |
| A0A845E050 | 207-340 | None |
| A0A7C3CNQ7 | 133-270 | None |
| A0A526ZT29 | 7-102 | None |
| A0A537MG16 | 61-192 | None |
| A0A0D7WV12 | 2-135 | None |
| A0A5P8WCV9 | 2-120 | None |
| A0A1Q8QKU0 | 102-224 | None |
| W6RUA1 | 180-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.