DPCstruct | MC25417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5XLJ3 | 1-78 | MSEYQYYEFQAIDRPLTSREMEELRRYSTRAEITPTRFRNEYNWGDFKGNSQEWIKKYFDAFLYFANWGTRILRLKIP |
| A0A5M6CS06 | 1-70 | MSEYQWIEFRAVDAPLDDAALDFMHEQSTRAQIDRWKFTNEYHFGEFRGDANEMMRRGYDVHVHYANYGV |
| A0A1E5QQW5 | 1-58 | None |
| A0A2N7TV82 | 1-78 | None |
| A0A7X6XIU9 | 16-81 | None |
| A0A4R3V2R1 | 1-78 | None |
| A0A0M8XZC9 | 1-79 | None |
| A0A1G9Y5N0 | 1-57 | None |
| A0A6L3AJS4 | 1-75 | None |
| D0LS18 | 125-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.