DPCstruct | MC25415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286U359 | 33-103 | DEETGFIIAKGFKIVNMACTLCHSSQIVIQSRSDREGWLETIRRMQAEEGMVNLDPEIEKEILDYLSTYYG |
| A0A7X3MR72 | 11-92 | GWTPAVQAQDERALPAGPGPDETVAWCSGCQSRALVMRQGMSRERWNDIITWMVENETMRKPCDEQRKVLLVYLSARFGAAK |
| A0A829YK20 | 2-100 | None |
| A0A2V9I5M7 | 38-131 | None |
| A0A7V9I2J1 | 3-68 | None |
| A0A524IFH4 | 4-93 | None |
| A0A524IFE9 | 71-172 | None |
| A0A2V7HGK8 | 10-106 | None |
| A0A437JBY8 | 25-131 | None |
| A0A523DAK3 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.