DPCstruct | MC25414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2Y5B1 | 6-122 | IIGFTDGEIYQRLGDIIGRFKLLECDKCAMAIVQWFKSYGINGTLLKLETKYDDEDFVLSERLEQRGIGESITRNGIHYGVEVRGKV… |
| A0A218QBN7 | 44-157 | QLSDNDIYQEVGKIVANFRILECYECAQAVMQWLAENNIERKVVIIKTKKRKEYFILSTRLEQRGISDSITENGKHYGVEVRGRVFD… |
| A0A3N6BC09 | 108-217 | None |
| A0A2V4DTD6 | 1-85 | None |
| A0A4U8Q3V5 | 294-401 | None |
| A0A480AP90 | 5-93 | None |
| E3FEP1 | 86-203 | None |
| A0A0J1GE73 | 774-892 | None |
| A0A1I5W3V2 | 6-114 | None |
| A0A3E1NZ43 | 157-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.