DPCstruct | MC25413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 195 ± 28 aa |
| Standard deviation of domain lengths | 27.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | CL0159- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8E623 | 204-392 | PQARYIAIFEADWSAATHPQDFPGLPHFSPLIGATHPANTRFWQPGAPASAGIERMAEEGSQSPLDAEIAEAQATGEAETLFRGGGL… |
| A0A2H2Y1V5 | 5-217 | KVIISVENLAPQNGTLVTPLWFGFHDGNFDIYDRGRPVSPGLESVAEDGATNLISQEFDLSGFGSVQGTIPGLAVTPGPIDSGEIAQ… |
| A0A2P8ZMR8 | 2-145 | None |
| A0A0R3U498 | 272-505 | None |
| A0A0B8P0U4 | 1-155 | None |
| A0A834NNP0 | 201-410 | None |
| A0A7M7HF66 | 22-234 | None |
| A0A7W1BIP9 | 327-535 | None |
| A0A1A9XUJ5 | 1-134 | None |
| A0A7Y3B2U3 | 18-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.